PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr003869.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 539aa    MW: 62071.3 Da    PI: 8.5469
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr003869.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS367.81.4e-1121665343372
         GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                  + L++cA+av+s+d++ a++l++++ +++sp+gd+++Rla yf++AL+arla+s +  y+ l +++t+    +e l+a+++++  +P+ k+ ++ aN+
  Pbr003869.1 166 TMLTQCAQAVASHDQRTASELIKKIGQHSSPNGDATERLAYYFANALEARLAGSRTPSYSPLLSTQTP---ATEILKAHQVYVTSCPFKKMLYFFANR 260
                  689**************************************************999999999998888...89************************* PP

         GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrv 196
                   I++ +e+++rvHii f+is+G+QWp+ +q L++Rp gpp+lRiT+++ p++g   +e++eet  rL+k+A++++vpfe+nv +a+++e++++e+L+v
  Pbr003869.1 261 KIMKLAENDTRVHIIHFGISYGFQWPCCIQYLSKRPVGPPNLRITAIELPQPGfrPTERVEETMCRLEKYAKRFDVPFEYNV-IAQKWETIRFEDLKV 357
                  ****************************************************9****************************9.7************** PP

         GRAS 197 kpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgrei 294
                  ++ E+++Vn++ +l ++ de+v ++s+rd+vL+l+k+++P+++++   +  +ns+ F++rf ea  +ysalfd++ea++p e e+r + E+++ gr+i
  Pbr003869.1 358 DKYEMIVVNCMRRLRHIRDETVVVSSPRDTVLNLIKKINPDLFIHGVVNGTYNSPFFVTRFREAPFHYSALFDMFEATIPCEYEHRLMFEKAIYGRDI 455
                  ************************************************************************************************** PP

         GRAS 295 vnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSa 372
                  +nv+ ceg +r+er et+++Wr r ++aGFk+vpl+++  k++k++l+ +   + ++++e+ +++++gWk+r ++++Sa
  Pbr003869.1 456 MNVIVCEGLDRVERPETYKHWRVRYHRAGFKQVPLDQELLKKVKAMLKLMRyHNDFQIDEDGHWMLQGWKGRIVIALSA 534
                  ************************************************9999999**********************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.676138515IPR005202Transcription factor GRAS
PfamPF035144.9E-110166534IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 539 aa     Download sequence    Send to blast
MDSNPGSDGD TIDISDCNHP VLKYISDILL EEDLEGKPCM LQDYLTLKAA EKSFYDVLNP  60
KGPPSFIQSP LPKGKKNHLR EDSDYTEEGR KNKQSAASND GPEPQEMFDE VLLCPDANHE  120
FEPCFHDQSV KTDGSGKLRS NKQPKISKTA RSKTKHKNRK VVYLCTMLTQ CAQAVASHDQ  180
RTASELIKKI GQHSSPNGDA TERLAYYFAN ALEARLAGSR TPSYSPLLST QTPATEILKA  240
HQVYVTSCPF KKMLYFFANR KIMKLAENDT RVHIIHFGIS YGFQWPCCIQ YLSKRPVGPP  300
NLRITAIELP QPGFRPTERV EETMCRLEKY AKRFDVPFEY NVIAQKWETI RFEDLKVDKY  360
EMIVVNCMRR LRHIRDETVV VSSPRDTVLN LIKKINPDLF IHGVVNGTYN SPFFVTRFRE  420
APFHYSALFD MFEATIPCEY EHRLMFEKAI YGRDIMNVIV CEGLDRVERP ETYKHWRVRY  480
HRAGFKQVPL DQELLKKVKA MLKLMRYHND FQIDEDGHWM LQGWKGRIVI ALSALKPA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-421685368375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008359007.10.0PREDICTED: scarecrow-like protein 30
RefseqXP_008359008.10.0PREDICTED: scarecrow-like protein 30
RefseqXP_008359009.10.0PREDICTED: scarecrow-like protein 30
RefseqXP_008384946.10.0PREDICTED: scarecrow-like protein 30
RefseqXP_008384947.10.0PREDICTED: scarecrow-like protein 30
RefseqXP_008384948.10.0PREDICTED: scarecrow-like protein 30
SwissprotQ9LTI51e-168SCL11_ARATH; Scarecrow-like protein 11
TrEMBLD9ZJB10.0D9ZJB1_MALDO; SCL domain class transcription factor
STRINGPOPTR_0001s24890.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59450.11e-165GRAS family protein